Lineage for d2oyca1 (2oyc A:2-294)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149297Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2149298Protein automated matches [190447] (51 species)
    not a true protein
  7. 2149520Species Human (Homo sapiens) [TaxId:9606] [188990] (13 PDB entries)
  8. 2149522Domain d2oyca1: 2oyc A:2-294 [231110]
    Other proteins in same PDB: d2oyca2
    automated match to d4bx3b_
    complexed with na, wo4

Details for d2oyca1

PDB Entry: 2oyc (more details), 1.72 Å

PDB Description: crystal structure of human pyridoxal phosphate phosphatase
PDB Compounds: (A:) pyridoxal phosphate phosphatase

SCOPe Domain Sequences for d2oyca1:

Sequence, based on SEQRES records: (download)

>d2oyca1 c.108.1.0 (A:2-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arcerlrgaalrdvlgraqgvlfdcdgvlwngeravpgapellerlaragkaalfvsnns
rrarpelalrfarlgfgglraeqlfssalcaarllrqrlpgppdapgavfvlggeglrae
lraaglrlagdpsagdgaaprvravlvgydehfsfaklreacahlrdpecllvatdrdpw
hplsdgsrtpgtgslaaavetasgrqalvvgkpspymfecitenfsidpartlmvgdrle
tdilfghrcgmttvltltgvsrleeaqaylaagqhdlvphyyvesiadltegl

Sequence, based on observed residues (ATOM records): (download)

>d2oyca1 c.108.1.0 (A:2-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arcerlrgaalrdvlgraqgvlfdcdgvlwngeravpgapellerlaragkaalfvsnns
rrarpelalrfarlgfgglraeqlfssalcaarllrqrlpgppdapgavfvlggeglrae
lraaglrlagdpsagaprvravlvgydehfsfaklreacahlrdpecllvatdrdpwhpl
sdgsrtpgtgslaaavetasgrqalvvgkpspymfecitenfsidpartlmvgdrletdi
lfghrcgmttvltltgvsrleeaqaylaagqhdlvphyyvesiadltegl

SCOPe Domain Coordinates for d2oyca1:

Click to download the PDB-style file with coordinates for d2oyca1.
(The format of our PDB-style files is described here.)

Timeline for d2oyca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oyca2