Lineage for d1bq5_2 (1bq5 160-340)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 292711Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 292712Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 293018Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins)
  6. 293096Protein Nitrite reductase, NIR [49551] (4 species)
    consists of two domains of this fold
  7. 293231Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (11 PDB entries)
  8. 293249Domain d1bq5_2: 1bq5 160-340 [23111]
    complexed with cu

Details for d1bq5_2

PDB Entry: 1bq5 (more details), 2.05 Å

PDB Description: nitrite reductase from alcaligenes xylosoxidans gifu 1051

SCOP Domain Sequences for d1bq5_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq5_2 b.6.1.3 (160-340) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
dglkdpqgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshiv
fngkvgaltgadaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdle
twfirggsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapap
i

SCOP Domain Coordinates for d1bq5_2:

Click to download the PDB-style file with coordinates for d1bq5_2.
(The format of our PDB-style files is described here.)

Timeline for d1bq5_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bq5_1