SCOPe 2.03: Domain d2oura_: 2our A:

Lineage for d2oura_ (2our A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (34 PDB entries)

8. Domain d2oura_: 2our A: [231107]
   automated match to d3wi2a_
   complexed with cmp, mg; mutant

Details for d2oura_

PDB Entry: 2our, 1.45 Å

PDB Description: crystal structure of pde10a2 mutant d674a in complex with camp

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d2oura_:

Sequence; same for both SEQRES and ATOM records:

>d2oura_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacalcsvtklwpvtk
ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
ptepllkacrdnlsqwekvirgee

Timeline for d2oura_:

• d2oura_ is new in SCOPe 2.03-stable
  
• d2oura_ appears in SCOPe 2.04
  
• d2oura_ appears in the current release, SCOPe 2.08, called d2oura1