![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:243274] [230690] (4 PDB entries) |
![]() | Domain d2orda1: 2ord A:1-385 [231103] Other proteins in same PDB: d2orda2, d2ordb2 automated match to d3nx3a_ complexed with gol, plp |
PDB Entry: 2ord (more details), 1.4 Å
SCOPe Domain Sequences for d2orda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2orda1 c.67.1.0 (A:1-385) automated matches {Thermotoga maritima [TaxId: 243274]} mylmntysrfpatfvygkgswiydekgnayldftsgiavnvlghshprlveaikdqaekl ihcsnlfwnrpqmelaellskntfggkvffantgteaneaaikiarkygkkksekkyril sahnsfhgrtlgsltatgqpkyqkpfeplvpgfeyfefnnvedlrrkmsedvcavflepi qgesgivpatkefleearklcdeydallvfdevqcgmgrtgklfayqkygvvpdvlttak glgggvpigavivneranvlepgdhgttfggnplacragvtvikeltkegfleeveekgn ylmkklqemkeeydvvadvrgmglmigiqfreevsnrevatkcfenkllvvpagnntirf lppltveygeidlavetlkkvlqgi
Timeline for d2orda1: