SCOPe 2.08: Domain d2or7a1: 2or7 A:6-111

Lineage for d2or7a1 (2or7 A:6-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2or7a1: 2or7 A:6-111 [231100]
   Other proteins in same PDB: d2or7a2, d2or7b2
   automated match to d2oypa_
   complexed with act

Details for d2or7a1

PDB Entry: 2or7, 1.5 Å

PDB Description: Tim-2

PDB Compounds: (A:) T-cell immunoglobulin and mucin domain-containing protein 2

SCOPe Domain Sequences for d2or7a1:

Sequence; same for both SEQRES and ATOM records:

>d2or7a1 b.1.1.0 (A:6-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avqglaghpvtlpciysthlggivpmcwglgecrhsycirsliwtngytvthqrnsryql
kgnisegnvsltientvvgdggpyccvveipgafhfvdymlevkpe

Timeline for d2or7a1:

• d2or7a1 first appeared in SCOPe 2.03, called d2or7a_
  
• d2or7a1 appears in SCOPe 2.07