Lineage for d2or7a1 (2or7 A:6-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759498Domain d2or7a1: 2or7 A:6-111 [231100]
    Other proteins in same PDB: d2or7a2, d2or7b2
    automated match to d2oypa_
    complexed with act

Details for d2or7a1

PDB Entry: 2or7 (more details), 1.5 Å

PDB Description: Tim-2
PDB Compounds: (A:) T-cell immunoglobulin and mucin domain-containing protein 2

SCOPe Domain Sequences for d2or7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2or7a1 b.1.1.0 (A:6-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avqglaghpvtlpciysthlggivpmcwglgecrhsycirsliwtngytvthqrnsryql
kgnisegnvsltientvvgdggpyccvveipgafhfvdymlevkpe

SCOPe Domain Coordinates for d2or7a1:

Click to download the PDB-style file with coordinates for d2or7a1.
(The format of our PDB-style files is described here.)

Timeline for d2or7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2or7a2