SCOP 1.73: Domain d1bq5a1: 1bq5 A:8-159

Lineage for d1bq5a1 (1bq5 A:8-159)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (26 PDB entries)

8. Domain d1bq5a1: 1bq5 A:8-159 [23110]

Details for d1bq5a1

PDB Entry: 1bq5, 2.05 Å

PDB Description: nitrite reductase from alcaligenes xylosoxidans gifu 1051

PDB Compounds: (A:) nitrite reductase

SCOP Domain Sequences for d1bq5a1:

Sequence; same for both SEQRES and ATOM records:

>d1bq5a1 b.6.1.3 (A:8-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsgmsgtlmvlpr

Timeline for d1bq5a1:

• d1bq5a1 first appeared (with stable ids) in SCOP 1.55, called d1bq5_1
  
• d1bq5a1 was called d1bq5_1 in SCOP 1.71
  
• d1bq5a1 appears in SCOP 1.75
  
• d1bq5a1 appears in the current release, SCOPe 2.08