SCOPe 2.03: Domain d2oqhc1: 2oqh C:2-122

Lineage for d2oqhc1 (2oqh C:2-122)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [231094] (1 PDB entry)

8. Domain d2oqhc1: 2oqh C:2-122 [231098]
   Other proteins in same PDB: d2oqha2, d2oqhc2
   automated match to d2p8ba1

Details for d2oqhc1

PDB Entry: 2oqh, 1.98 Å

PDB Description: crystal structure of an isomerase from streptomyces coelicolor a3(2)

PDB Compounds: (C:) Putative isomerase

SCOPe Domain Sequences for d2oqhc1:

Sequence; same for both SEQRES and ATOM records:

>d2oqhc1 d.54.1.0 (C:2-122) automated matches {Streptomyces coelicolor [TaxId: 100226]}
slkitdvdvwvvnlplvnpftssfetktgetrtvvrvrtdsgvegwgetmwgapvaaivr
rmapdligtspfaleafhrkqhmvpffygylgyaaiaavdvacwdamgkatgqsvtdllg
g

Timeline for d2oqhc1:

• d2oqhc1 is new in SCOPe 2.03-stable
  
• d2oqhc1 appears in SCOPe 2.04
  
• d2oqhc1 appears in the current release, SCOPe 2.08