Lineage for d2ohij2 (2ohi J:255-403)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856900Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2856901Protein automated matches [190158] (31 species)
    not a true protein
  7. 2857006Species Methanothermobacter thermautotrophicus [TaxId:145262] [231062] (3 PDB entries)
  8. 2857021Domain d2ohij2: 2ohi J:255-403 [231077]
    Other proteins in same PDB: d2ohia1, d2ohib1, d2ohid1, d2ohie1, d2ohig1, d2ohih1, d2ohii1, d2ohij1
    automated match to d1ycfa1
    complexed with cl, fe, fmn

Details for d2ohij2

PDB Entry: 2ohi (more details), 2.3 Å

PDB Description: Crystal Structure of coenzyme F420H2 oxidase (FprA), a diiron flavoprotein, reduced state
PDB Compounds: (J:) Type A flavoprotein fprA

SCOPe Domain Sequences for d2ohij2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ohij2 c.23.5.0 (J:255-403) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
vdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrseivkdilesgaialg
aptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatgtmkellaeagfdva
ceeevyyvptgdeldacfeagrklaaeir

SCOPe Domain Coordinates for d2ohij2:

Click to download the PDB-style file with coordinates for d2ohij2.
(The format of our PDB-style files is described here.)

Timeline for d2ohij2: