SCOPe 2.03: Domain d2ohig2: 2ohi G:255-403

Lineage for d2ohig2 (2ohi G:255-403)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (11 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [231062] (3 PDB entries)

8. Domain d2ohig2: 2ohi G:255-403 [231076]
   Other proteins in same PDB: d2ohia1, d2ohib1, d2ohid1, d2ohie1, d2ohig1, d2ohih1, d2ohii1, d2ohij1
   automated match to d1ycfa1
   complexed with cl, fe, fmn

Details for d2ohig2

PDB Entry: 2ohi, 2.3 Å

PDB Description: Crystal Structure of coenzyme F420H2 oxidase (FprA), a diiron flavoprotein, reduced state

PDB Compounds: (G:) Type A flavoprotein fprA

SCOPe Domain Sequences for d2ohig2:

Sequence; same for both SEQRES and ATOM records:

>d2ohig2 c.23.5.0 (G:255-403) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
vdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrseivkdilesgaialg
aptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatgtmkellaeagfdva
ceeevyyvptgdeldacfeagrklaaeir

Timeline for d2ohig2:

• d2ohig2 is new in SCOPe 2.03-stable
  
• d2ohig2 appears in SCOPe 2.04
  
• d2ohig2 appears in the current release, SCOPe 2.08