SCOPe 2.04: Domain d2ohhb2: 2ohh B:255-403

Lineage for d2ohhb2 (2ohh B:255-403)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (17 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [231062] (3 PDB entries)

8. Domain d2ohhb2: 2ohh B:255-403 [231072]
   Other proteins in same PDB: d2ohha1, d2ohhb1, d2ohhd1, d2ohhe1
   automated match to d1ycfa1
   complexed with fe, fmn, so4

Details for d2ohhb2

PDB Entry: 2ohh, 1.7 Å

PDB Description: Crystal Structure of coenzyme F420H2 oxidase (FprA), a diiron flavoprotein, active oxidized state

PDB Compounds: (B:) Type A flavoprotein fprA

SCOPe Domain Sequences for d2ohhb2:

Sequence; same for both SEQRES and ATOM records:

>d2ohhb2 c.23.5.0 (B:255-403) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
vdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrseivkdilesgaialg
aptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatgtmkellaeagfdva
ceeevyyvptgdeldacfeagrklaaeir

Timeline for d2ohhb2:

• d2ohhb2 first appeared in SCOPe 2.03
  
• d2ohhb2 appears in SCOPe 2.05
  
• d2ohhb2 appears in the current release, SCOPe 2.08