Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (24 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:145262] [231062] (3 PDB entries) |
Domain d2ohha2: 2ohh A:255-403 [231070] Other proteins in same PDB: d2ohha1, d2ohhb1, d2ohhd1, d2ohhe1 automated match to d1ycfa1 complexed with fe, fmn, so4 |
PDB Entry: 2ohh (more details), 1.7 Å
SCOPe Domain Sequences for d2ohha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ohha2 c.23.5.0 (A:255-403) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]} vdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrseivkdilesgaialg aptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatgtmkellaeagfdva ceeevyyvptgdeldacfeagrklaaeir
Timeline for d2ohha2: