Lineage for d2ohha2 (2ohh A:255-403)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2116045Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2116046Protein automated matches [190158] (24 species)
    not a true protein
  7. 2116118Species Methanothermobacter thermautotrophicus [TaxId:145262] [231062] (3 PDB entries)
  8. 2116119Domain d2ohha2: 2ohh A:255-403 [231070]
    Other proteins in same PDB: d2ohha1, d2ohhb1, d2ohhd1, d2ohhe1
    automated match to d1ycfa1
    complexed with fe, fmn, so4

Details for d2ohha2

PDB Entry: 2ohh (more details), 1.7 Å

PDB Description: Crystal Structure of coenzyme F420H2 oxidase (FprA), a diiron flavoprotein, active oxidized state
PDB Compounds: (A:) Type A flavoprotein fprA

SCOPe Domain Sequences for d2ohha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ohha2 c.23.5.0 (A:255-403) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
vdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrseivkdilesgaialg
aptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatgtmkellaeagfdva
ceeevyyvptgdeldacfeagrklaaeir

SCOPe Domain Coordinates for d2ohha2:

Click to download the PDB-style file with coordinates for d2ohha2.
(The format of our PDB-style files is described here.)

Timeline for d2ohha2: