SCOP 1.65: Domain d1as7c2: 1as7 C:167-340

Lineage for d1as7c2 (1as7 C:167-340)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins)

6. Protein Nitrite reductase, NIR [49551] (4 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (21 PDB entries)

8. Domain d1as7c2: 1as7 C:167-340 [23107]
   complexed with cu

Details for d1as7c2

PDB Entry: 1as7, 2 Å

PDB Description: structure of alcaligenes faecalis nitrite reductase at cryo temperature

SCOP Domain Sequences for d1as7c2:

Sequence; same for both SEQRES and ATOM records:

>d1as7c2 b.6.1.3 (C:167-340) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt

Timeline for d1as7c2:

• d1as7c2 first appeared (with stable ids) in SCOP 1.55
  
• d1as7c2 appears in SCOP 1.63
  
• d1as7c2 appears in SCOP 1.67
  
• d1as7c2 appears in the current release, SCOPe 2.08