Lineage for d2oejb2 (2oej B:121-413)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088773Family c.1.14.0: automated matches [227297] (1 protein)
    not a true family
  6. 2088774Protein automated matches [227123] (7 species)
    not a true protein
  7. 2088788Species Geobacillus kaustophilus [TaxId:1462] [231052] (4 PDB entries)
  8. 2088795Domain d2oejb2: 2oej B:121-413 [231057]
    Other proteins in same PDB: d2oeja1, d2oejb1
    automated match to d4nasa2
    complexed with po4; mutant

Details for d2oejb2

PDB Entry: 2oej (more details), 2.55 Å

PDB Description: Crystal structure of a rubisco-like protein from Geobacillus kaustophilus (tetramutant form), liganded with phosphate ions
PDB Compounds: (B:) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase

SCOPe Domain Sequences for d2oejb2:

Sequence, based on SEQRES records: (download)

>d2oejb2 c.1.14.0 (B:121-413) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
pgprfgidgirdrvgvhnrpllmsifkgmigrdlayltpelkkqalggvdlvkddeilfd
sellpfekritegkaalqevyeqtgkrtlyavnltgktfalkdkakraaelgadvllfnv
faygldvlqalredeeiavpimahpvfsgavtpsefygvapslwlgkllrlagadfvlfp
spygsvasereqalgiaraltddqepfarafpvpsagihpglvpliirdfgldtivnagg
gihghphgaigggrafraaidavlagrplraaaaenealqkaidrwgvvevea

Sequence, based on observed residues (ATOM records): (download)

>d2oejb2 c.1.14.0 (B:121-413) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
pgprfgidgirdrvgvhnrpllmsifkgmigrdlayltpelkkqalggvdlvkddeilfd
sellpfekritegkaalqevyeqtgkrtlyavnltgktfalkdkakraaelgadvllfnv
faygldvlqalredeeiavpimahpvfsgavtpsefygvapslwlgkllrlagadfvlfp
spyereqalgiaraltddqepfarafpvpsagihpglvpliirdfgldtivnagggihgh
phgaigggrafraaidavlagrplraaaaenealqkaidrwgvvevea

SCOPe Domain Coordinates for d2oejb2:

Click to download the PDB-style file with coordinates for d2oejb2.
(The format of our PDB-style files is described here.)

Timeline for d2oejb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oejb1