SCOPe 2.06: Domain d2oj5c2: 2oj5 C:313-454

Lineage for d2oj5c2 (2oj5 C:313-454)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.2: Reovirus attachment protein sigma 1 head domain [69225] (2 proteins)

6. Protein automated matches [231033] (1 species)
   not a true protein

7. Species Reovirus sp. [TaxId:10891] [231036] (2 PDB entries)

8. Domain d2oj5c2: 2oj5 C:313-454 [231050]
   Other proteins in same PDB: d2oj5b1, d2oj5c1, d2oj5f1
   automated match to d1kkea2
   complexed with gol, mg

Details for d2oj5c2

PDB Entry: 2oj5, 1.75 Å

PDB Description: Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at 1.75 A resolution

PDB Compounds: (C:) Viral attachment protein sigma 1

SCOPe Domain Sequences for d2oj5c2:

Sequence; same for both SEQRES and ATOM records:

>d2oj5c2 b.21.1.2 (C:313-454) automated matches {Reovirus sp. [TaxId: 10891]}
yrfrqsmwigivsysgsglnwrvqvnsdifivddyihiclpafdgfsiadggdlslnfvt
gllpplltgdtepafhndvvtygaqtvaiglssggtpqymsknlwveqwqdgvlrlrveg
ggsithsnskwpamtvsyprsf

Timeline for d2oj5c2:

• d2oj5c2 first appeared in SCOPe 2.03
  
• d2oj5c2 appears in SCOPe 2.05
  
• d2oj5c2 appears in SCOPe 2.07
  
• d2oj5c2 appears in the current release, SCOPe 2.08