Lineage for d2oj5c2 (2oj5 C:313-454)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2777028Family b.21.1.2: Reovirus attachment protein sigma 1 head domain [69225] (2 proteins)
  6. 2777034Protein automated matches [231033] (1 species)
    not a true protein
  7. 2777035Species Reovirus sp. [TaxId:10891] [231036] (2 PDB entries)
  8. 2777038Domain d2oj5c2: 2oj5 C:313-454 [231050]
    Other proteins in same PDB: d2oj5b1, d2oj5c1, d2oj5f1
    automated match to d1kkea2
    complexed with gol, mg

Details for d2oj5c2

PDB Entry: 2oj5 (more details), 1.75 Å

PDB Description: Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at 1.75 A resolution
PDB Compounds: (C:) Viral attachment protein sigma 1

SCOPe Domain Sequences for d2oj5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oj5c2 b.21.1.2 (C:313-454) automated matches {Reovirus sp. [TaxId: 10891]}
yrfrqsmwigivsysgsglnwrvqvnsdifivddyihiclpafdgfsiadggdlslnfvt
gllpplltgdtepafhndvvtygaqtvaiglssggtpqymsknlwveqwqdgvlrlrveg
ggsithsnskwpamtvsyprsf

SCOPe Domain Coordinates for d2oj5c2:

Click to download the PDB-style file with coordinates for d2oj5c2.
(The format of our PDB-style files is described here.)

Timeline for d2oj5c2: