![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
![]() | Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
![]() | Family b.21.1.2: Reovirus attachment protein sigma 1 head domain [69225] (2 proteins) |
![]() | Protein automated matches [231033] (1 species) not a true protein |
![]() | Species Reovirus sp. [TaxId:10891] [231036] (2 PDB entries) |
![]() | Domain d2oj5b2: 2oj5 B:313-455 [231049] Other proteins in same PDB: d2oj5b1, d2oj5c1, d2oj5f1 automated match to d1kkea2 complexed with gol, mg |
PDB Entry: 2oj5 (more details), 1.75 Å
SCOPe Domain Sequences for d2oj5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oj5b2 b.21.1.2 (B:313-455) automated matches {Reovirus sp. [TaxId: 10891]} yrfrqsmwigivsysgsglnwrvqvnsdifivddyihiclpafdgfsiadggdlslnfvt gllpplltgdtepafhndvvtygaqtvaiglssggtpqymsknlwveqwqdgvlrlrveg ggsithsnskwpamtvsyprsft
Timeline for d2oj5b2: