SCOPe 2.08: Domain d2oj5f2: 2oj5 F:313-455

Lineage for d2oj5f2 (2oj5 F:313-455)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.2: Reovirus attachment protein sigma 1 head domain [69225] (2 proteins)

6. Protein automated matches [231033] (1 species)
   not a true protein

7. Species Reovirus sp. [TaxId:10891] [231036] (2 PDB entries)

8. Domain d2oj5f2: 2oj5 F:313-455 [231048]
   Other proteins in same PDB: d2oj5b1, d2oj5c1, d2oj5f1
   automated match to d1kkea2
   complexed with gol, mg

Details for d2oj5f2

PDB Entry: 2oj5, 1.75 Å

PDB Description: Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at 1.75 A resolution

PDB Compounds: (F:) Viral attachment protein sigma 1

SCOPe Domain Sequences for d2oj5f2:

Sequence; same for both SEQRES and ATOM records:

>d2oj5f2 b.21.1.2 (F:313-455) automated matches {Reovirus sp. [TaxId: 10891]}
yrfrqsmwigivsysgsglnwrvqvnsdifivddyihiclpafdgfsiadggdlslnfvt
gllpplltgdtepafhndvvtygaqtvaiglssggtpqymsknlwveqwqdgvlrlrveg
ggsithsnskwpamtvsyprsft

Timeline for d2oj5f2:

• d2oj5f2 first appeared in SCOPe 2.03
  
• d2oj5f2 appears in SCOPe 2.07