![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
![]() | Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
![]() | Family b.21.1.2: Reovirus attachment protein sigma 1 head domain [69225] (2 proteins) |
![]() | Protein automated matches [231033] (1 species) not a true protein |
![]() | Species Reovirus sp. [TaxId:10891] [231036] (2 PDB entries) |
![]() | Domain d2oj6e1: 2oj6 E:313-454 [231045] Other proteins in same PDB: d2oj6c1 automated match to d1kkea2 complexed with mg; mutant |
PDB Entry: 2oj6 (more details), 1.85 Å
SCOPe Domain Sequences for d2oj6e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oj6e1 b.21.1.2 (E:313-454) automated matches {Reovirus sp. [TaxId: 10891]} yrfrqsmwigivsysgsglnwrvqvnsdifivndyihiclpafdgfsiadggdlslnfvt gllpplltgdtepafhndvvtygaqtvaiglssggtpqymsknlwveqwqdgvlrlrveg ggsithsnskwpamtvsyprsf
Timeline for d2oj6e1: