Lineage for d2oj5d1 (2oj5 D:313-454)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1306222Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 1306223Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 1306340Family b.21.1.2: Reovirus attachment protein sigma 1 head domain [69225] (2 proteins)
  6. 1306346Protein automated matches [231033] (1 species)
    not a true protein
  7. 1306347Species Reovirus sp. [TaxId:10891] [231036] (2 PDB entries)
  8. 1306356Domain d2oj5d1: 2oj5 D:313-454 [231040]
    Other proteins in same PDB: d2oj5b1, d2oj5c1, d2oj5f1
    automated match to d1kkea2
    complexed with gol, mg

Details for d2oj5d1

PDB Entry: 2oj5 (more details), 1.75 Å

PDB Description: Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at 1.75 A resolution
PDB Compounds: (D:) Viral attachment protein sigma 1

SCOPe Domain Sequences for d2oj5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oj5d1 b.21.1.2 (D:313-454) automated matches {Reovirus sp. [TaxId: 10891]}
yrfrqsmwigivsysgsglnwrvqvnsdifivddyihiclpafdgfsiadggdlslnfvt
gllpplltgdtepafhndvvtygaqtvaiglssggtpqymsknlwveqwqdgvlrlrveg
ggsithsnskwpamtvsyprsf

SCOPe Domain Coordinates for d2oj5d1:

Click to download the PDB-style file with coordinates for d2oj5d1.
(The format of our PDB-style files is described here.)

Timeline for d2oj5d1: