SCOPe 2.06: Domain d2ohjd1: 2ohj D:1-254

Lineage for d2ohjd1 (2ohj D:1-254)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (18 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [231016] (3 PDB entries)

8. Domain d2ohjd1: 2ohj D:1-254 [231031]
   Other proteins in same PDB: d2ohja2, d2ohjb2, d2ohjd2, d2ohje2
   automated match to d1ycfa2
   complexed with cl, fe, fmn

Details for d2ohjd1

PDB Entry: 2ohj, 2.26 Å

PDB Description: Crystal Structure of coenzyme F420H2 oxidase (FprA), a diiron flavoprotein, inactive oxidized state

PDB Compounds: (D:) Type A flavoprotein fprA

SCOPe Domain Sequences for d2ohjd1:

Sequence; same for both SEQRES and ATOM records:

>d2ohjd1 d.157.1.0 (D:1-254) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
mkiieaytgwatgm

Timeline for d2ohjd1:

• d2ohjd1 first appeared in SCOPe 2.03
  
• d2ohjd1 appears in SCOPe 2.05
  
• d2ohjd1 appears in SCOPe 2.07
  
• d2ohjd1 appears in the current release, SCOPe 2.08