Lineage for d2ohja1 (2ohj A:1-254)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937671Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1937672Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1938079Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1938080Protein automated matches [190418] (15 species)
    not a true protein
  7. 1938172Species Methanothermobacter thermautotrophicus [TaxId:145262] [231016] (3 PDB entries)
  8. 1938177Domain d2ohja1: 2ohj A:1-254 [231029]
    Other proteins in same PDB: d2ohja2, d2ohjb2, d2ohjd2, d2ohje2
    automated match to d1ycfa2
    complexed with cl, fe, fmn

Details for d2ohja1

PDB Entry: 2ohj (more details), 2.26 Å

PDB Description: Crystal Structure of coenzyme F420H2 oxidase (FprA), a diiron flavoprotein, inactive oxidized state
PDB Compounds: (A:) Type A flavoprotein fprA

SCOPe Domain Sequences for d2ohja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ohja1 d.157.1.0 (A:1-254) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
mkiieaytgwatgm

SCOPe Domain Coordinates for d2ohja1:

Click to download the PDB-style file with coordinates for d2ohja1.
(The format of our PDB-style files is described here.)

Timeline for d2ohja1: