Lineage for d2ohhe1 (2ohh E:1-254)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603807Species Methanothermobacter thermautotrophicus [TaxId:145262] [231016] (3 PDB entries)
  8. 2603811Domain d2ohhe1: 2ohh E:1-254 [231020]
    Other proteins in same PDB: d2ohha2, d2ohhb2, d2ohhe2
    automated match to d1ycfa2
    complexed with fe, fmn, so4

Details for d2ohhe1

PDB Entry: 2ohh (more details), 1.7 Å

PDB Description: Crystal Structure of coenzyme F420H2 oxidase (FprA), a diiron flavoprotein, active oxidized state
PDB Compounds: (E:) Type A flavoprotein fprA

SCOPe Domain Sequences for d2ohhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ohhe1 d.157.1.0 (E:1-254) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
mkiieaytgwatgm

SCOPe Domain Coordinates for d2ohhe1:

Click to download the PDB-style file with coordinates for d2ohhe1.
(The format of our PDB-style files is described here.)

Timeline for d2ohhe1: