![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (8 species) not a true protein |
![]() | Species Methanothermobacter thermautotrophicus [TaxId:145262] [231016] (3 PDB entries) |
![]() | Domain d2ohhb1: 2ohh B:1-254 [231019] Other proteins in same PDB: d2ohha2, d2ohhb2, d2ohhe2 automated match to d1ycfa2 complexed with fe, fmn, so4 |
PDB Entry: 2ohh (more details), 1.7 Å
SCOPe Domain Sequences for d2ohhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ohhb1 d.157.1.0 (B:1-254) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]} mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp mkiieaytgwatgm
Timeline for d2ohhb1: