Lineage for d2oelb1 (2oel B:2-120)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559642Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2559863Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2559864Protein automated matches [226983] (27 species)
    not a true protein
  7. 2559896Species Geobacillus kaustophilus [TaxId:1462] [231000] (4 PDB entries)
  8. 2559902Domain d2oelb1: 2oel B:2-120 [231006]
    Other proteins in same PDB: d2oela2, d2oelb2
    automated match to d4nasa1
    complexed with co3, mg

Details for d2oelb1

PDB Entry: 2oel (more details), 1.8 Å

PDB Description: Crystal structure of a rubisco-like protein from Geobacillus kaustophilus liganded with Mg2+ and HCO3- ions
PDB Compounds: (B:) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase

SCOPe Domain Sequences for d2oelb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oelb1 d.58.9.0 (B:2-120) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
savmatyllhdetdirkkaegialgltigtwtdlpaleqeqlrkhkgevvaieelgeser
vnayfgkrlkraivkiayptvnfsadlpallvttfgklsldgevrlldlefpdewkrqf

SCOPe Domain Coordinates for d2oelb1:

Click to download the PDB-style file with coordinates for d2oelb1.
(The format of our PDB-style files is described here.)

Timeline for d2oelb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oelb2