Lineage for d2oela1 (2oel A:2-120)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953031Species Geobacillus kaustophilus [TaxId:1462] [231000] (4 PDB entries)
  8. 2953036Domain d2oela1: 2oel A:2-120 [231004]
    Other proteins in same PDB: d2oela2, d2oelb2
    automated match to d4nasa1
    complexed with co3, mg

Details for d2oela1

PDB Entry: 2oel (more details), 1.8 Å

PDB Description: Crystal structure of a rubisco-like protein from Geobacillus kaustophilus liganded with Mg2+ and HCO3- ions
PDB Compounds: (A:) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase

SCOPe Domain Sequences for d2oela1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oela1 d.58.9.0 (A:2-120) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
savmatyllhdetdirkkaegialgltigtwtdlpaleqeqlrkhkgevvaieelgeser
vnayfgkrlkraivkiayptvnfsadlpallvttfgklsldgevrlldlefpdewkrqf

SCOPe Domain Coordinates for d2oela1:

Click to download the PDB-style file with coordinates for d2oela1.
(The format of our PDB-style files is described here.)

Timeline for d2oela1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oela2