SCOPe 2.08: Domain d2oela1: 2oel A:2-120

Lineage for d2oela1 (2oel A:2-120)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [231000] (4 PDB entries)

8. Domain d2oela1: 2oel A:2-120 [231004]
   Other proteins in same PDB: d2oela2, d2oelb2
   automated match to d4nasa1
   complexed with co3, mg

Details for d2oela1

PDB Entry: 2oel, 1.8 Å

PDB Description: Crystal structure of a rubisco-like protein from Geobacillus kaustophilus liganded with Mg2+ and HCO3- ions

PDB Compounds: (A:) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase

SCOPe Domain Sequences for d2oela1:

Sequence; same for both SEQRES and ATOM records:

>d2oela1 d.58.9.0 (A:2-120) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
savmatyllhdetdirkkaegialgltigtwtdlpaleqeqlrkhkgevvaieelgeser
vnayfgkrlkraivkiayptvnfsadlpallvttfgklsldgevrlldlefpdewkrqf

Timeline for d2oela1:

• d2oela1 first appeared in SCOPe 2.03
  
• d2oela1 appears in SCOPe 2.07