Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (27 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:1462] [231000] (4 PDB entries) |
Domain d2oeka1: 2oek A:2-120 [231002] Other proteins in same PDB: d2oeka2, d2oekb2 automated match to d4nasa1 complexed with mg |
PDB Entry: 2oek (more details), 1.8 Å
SCOPe Domain Sequences for d2oeka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oeka1 d.58.9.0 (A:2-120) automated matches {Geobacillus kaustophilus [TaxId: 1462]} savmatyllhdetdirkkaegialgltigtwtdlpaleqeqlrkhkgevvaieelgeser vnayfgkrlkraivkiayptvnfsadlpallvttfgklsldgevrlldlefpdewkrqf
Timeline for d2oeka1: