SCOPe 2.08: Domain d2oeja1: 2oej A:2-120

Lineage for d2oeja1 (2oej A:2-120)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [231000] (4 PDB entries)

8. Domain d2oeja1: 2oej A:2-120 [231001]
   Other proteins in same PDB: d2oeja2, d2oejb2
   automated match to d4nasa1
   complexed with po4; mutant

Details for d2oeja1

PDB Entry: 2oej, 2.55 Å

PDB Description: crystal structure of a rubisco-like protein from geobacillus kaustophilus (tetramutant form), liganded with phosphate ions

PDB Compounds: (A:) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase

SCOPe Domain Sequences for d2oeja1:

Sequence; same for both SEQRES and ATOM records:

>d2oeja1 d.58.9.0 (A:2-120) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
savmatyllhdetdirkkaegialgltigtwtdlpaleqeqlrkhkgevvaieelgeser
vnayfgkrlkraivkiayptvnfsadlpallvttfgklsldgevrlldlefpdewkrqf

Timeline for d2oeja1:

• d2oeja1 first appeared in SCOPe 2.03
  
• d2oeja1 appears in SCOPe 2.07