| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
| Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
| Protein automated matches [227009] (16 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [230992] (2 PDB entries) |
| Domain d2obae1: 2oba E:2-118 [230997] Other proteins in same PDB: d2obaa2, d2obab2, d2obac2, d2obad2, d2obae2, d2obaf2 automated match to d3i2ba_ complexed with zn |
PDB Entry: 2oba (more details), 2.33 Å
SCOPe Domain Sequences for d2obae1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2obae1 d.96.1.0 (E:2-118) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
elfkeftfesahrlphvpeghkcgrlhghsfrvaihiegevdphtgwirdfaeikaifkp
iyeqldhnylndipglenptsenlcrwiwqqlkpllpelskvrvhetctsgceyrgd
Timeline for d2obae1: