| Class b: All beta proteins [48724] (126 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (5 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins) |
| Protein Nitrite reductase, NIR [49551] (4 species) consists of two domains of this fold |
| Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (21 PDB entries) |
| Domain d1aq8b2: 1aq8 B:167-339 [23099] |
PDB Entry: 1aq8 (more details), 2 Å
SCOP Domain Sequences for d1aq8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aq8b2 b.6.1.3 (B:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg
Timeline for d1aq8b2:
View in 3DDomains from other chains: (mouse over for more information) d1aq8a1, d1aq8a2, d1aq8c1, d1aq8c2 |