![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) |
![]() | Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419327] (31 PDB entries) Uniprot P38501 |
![]() | Domain d1aq8b2: 1aq8 B:167-339 [23099] Other proteins in same PDB: d1aq8a1, d1aq8b1, d1aq8c1 complexed with cu has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1aq8 (more details), 2 Å
SCOPe Domain Sequences for d1aq8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aq8b2 b.6.1.3 (B:167-339) Nitrite reductase, NIR, C-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]} gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg
Timeline for d1aq8b2:
![]() Domains from other chains: (mouse over for more information) d1aq8a1, d1aq8a2, d1aq8c1, d1aq8c2 |