Lineage for d2nzla_ (2nzl A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (21 species)
    not a true protein
  7. 2080558Species Human (Homo sapiens) [TaxId:9606] [189110] (5 PDB entries)
  8. 2080559Domain d2nzla_: 2nzl A: [230987]
    automated match to d2rdta_
    complexed with fmn, glv

Details for d2nzla_

PDB Entry: 2nzl (more details), 1.35 Å

PDB Description: crystal structure of human hydroxyacid oxidase 1
PDB Compounds: (A:) hydroxyacid oxidase 1

SCOPe Domain Sequences for d2nzla_:

Sequence, based on SEQRES records: (download)

>d2nzla_ c.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaetdls
tsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevaeagp
ealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklppqlrm
knfetstlsfspeenfgddsglaayvakaidpsiswedikwlrrltslpivakgilrgdd
areavkhglngilvsnhgarqldgvpatidvlpeiveavegkvevfldggvrkgtdvlka
lalgakavfvgrpivwglafqgekgvqdvleilkeefrlamalsgcqnvkvidktlvr

Sequence, based on observed residues (ATOM records): (download)

>d2nzla_ c.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaetdls
tsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevaeagp
ealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklppqlrm
knfglaayvakaidpsiswedikwlrtslpivakgilrgddareavkhglngilvsnhga
rqldgvpatidvlpeiveavegkvevfldggvrkgtdvlkalalgakavfvgrpivwgla
fqgekgvqdvleilkeefrlamalsgcqnvkvidktlvr

SCOPe Domain Coordinates for d2nzla_:

Click to download the PDB-style file with coordinates for d2nzla_.
(The format of our PDB-style files is described here.)

Timeline for d2nzla_: