Lineage for d2nz6a1 (2nz6 A:-15-1311)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116650Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2116651Protein automated matches [190475] (8 species)
    not a true protein
  7. 2116663Species Human (Homo sapiens) [TaxId:9606] [187400] (116 PDB entries)
  8. 2116745Domain d2nz6a1: 2nz6 A:-15-1311 [230986]
    Other proteins in same PDB: d2nz6a2
    automated match to d2h04a_
    complexed with cl, ni, po4; mutant

Details for d2nz6a1

PDB Entry: 2nz6 (more details), 2.3 Å

PDB Description: crystal structure of the ptprj inactivating mutant c1239s
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase eta

SCOPe Domain Sequences for d2nz6a1:

Sequence, based on SEQRES records: (download)

>d2nz6a1 c.45.1.0 (A:-15-1311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssgvdlgtenlyfqsmklirvenfeayfkkqqadsncgfaeeyedlklvgisqpkyaael
aenrgknrynnvlpydisrvklsvqthstddyinanympgyhskkdfiatqgplpntlkd
fwrmvweknvyaiimltkcveqgrtkceeywpskqaqdygditvamtseivlpewtirdf
tvkniqtseshplrqfhftswpdhgvpdttdllinfrylvrdymkqsppespilvhssag
vgrtgtfiaidrliyqienentvdvygivydlrmhrplmvqtedqyvflnqcvldivrsq
kdskvdliy

Sequence, based on observed residues (ATOM records): (download)

>d2nz6a1 c.45.1.0 (A:-15-1311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssgvdlgtenlyfqsmklirvenfeayfkkqqadsncgfaeeyedlklvgisqpkyaael
aenrgknrynnvlpydisrvklsvqthstddyinanympgyhskkdfiatqgplpntlkd
fwrmvweknvyaiimltkeywpskqaqdygditvamtseivlpewtirdftvkniqtses
hplrqfhftswpdhgvpdttdllinfrylvrdymespilvhssagvgrtgtfiaidrliy
qienentvdvygivydlrmhrplmvqtedqyvflnqcvldivrsqkdliy

SCOPe Domain Coordinates for d2nz6a1:

Click to download the PDB-style file with coordinates for d2nz6a1.
(The format of our PDB-style files is described here.)

Timeline for d2nz6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nz6a2