Lineage for d2nv2a_ (2nv2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827424Family c.1.2.6: PdxS-like [141755] (2 proteins)
    Pfam PF01680; SOR/SNZ
  6. 2827433Protein automated matches [193117] (4 species)
    not a true protein
  7. 2827434Species Bacillus subtilis [TaxId:1423] [230975] (2 PDB entries)
  8. 2827441Domain d2nv2a_: 2nv2 A: [230976]
    Other proteins in same PDB: d2nv2b_, d2nv2d_, d2nv2f_, d2nv2h_, d2nv2j_, d2nv2l_, d2nv2n_, d2nv2p_, d2nv2r_, d2nv2t_, d2nv2v_, d2nv2x_
    automated match to d4jdyc_
    complexed with cl, edo, gln

Details for d2nv2a_

PDB Entry: 2nv2 (more details), 2.12 Å

PDB Description: structure of the plp synthase complex pdx1/2 (yaad/e) from bacillus subtilis
PDB Compounds: (A:) Pyridoxal biosynthesis lyase pdxS

SCOPe Domain Sequences for d2nv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nv2a_ c.1.2.6 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
aqtgtervkrgmaemqkggvimdvinaeqakiaeeagavavmalervpadiraaggvarm
adptiveevmnavsipvmakarighivearvleamgvdyidesevltpadeefhlnkney
tvpfvcgcrdlgeatrriaegasmlrtkgepgtgniveavrhmrkvnaqvrkvvamsede
lmteaknlgapyelllqikkdgklpvvnfaaggvatpadaalmmqlgadgvfvgsgifks
dnpakfakaiveatthftdykliaelsk

SCOPe Domain Coordinates for d2nv2a_:

Click to download the PDB-style file with coordinates for d2nv2a_.
(The format of our PDB-style files is described here.)

Timeline for d2nv2a_: