Lineage for d2nqdb_ (2nqd B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634821Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1634822Protein automated matches [190230] (16 species)
    not a true protein
  7. 1634834Species Human (Homo sapiens) [TaxId:9606] [187072] (30 PDB entries)
  8. 1634842Domain d2nqdb_: 2nqd B: [230974]
    Other proteins in same PDB: d2nqda_
    automated match to d3of8a_
    complexed with cl, na

Details for d2nqdb_

PDB Entry: 2nqd (more details), 1.75 Å

PDB Description: crystal structure of cysteine protease inhibitor, chagasin, in complex with human cathepsin l
PDB Compounds: (B:) Cathepsin L

SCOPe Domain Sequences for d2nqdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqdb_ d.3.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eaprsvdwrekgyvtpvknqgqcgsawafsatgalegqmfrktgrlislseqnlvdcsgp
qgnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqe
kalmkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdn
nkywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

SCOPe Domain Coordinates for d2nqdb_:

Click to download the PDB-style file with coordinates for d2nqdb_.
(The format of our PDB-style files is described here.)

Timeline for d2nqdb_: