SCOPe 2.02: Domain d1aq8a2: 1aq8 A:167-339

Lineage for d1aq8a2 (1aq8 A:167-339)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (37 PDB entries)
   Uniprot P38501

8. Domain d1aq8a2: 1aq8 A:167-339 [23097]
   complexed with cu

Details for d1aq8a2

PDB Entry: 1aq8, 2 Å

PDB Description: structure of alcaligenes faecalis nitrite reductase reduced with ascorbate

PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1aq8a2:

Sequence; same for both SEQRES and ATOM records:

>d1aq8a2 b.6.1.3 (A:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

Timeline for d1aq8a2:

• d1aq8a2 first appeared (with stable ids) in SCOP 1.55
  
• d1aq8a2 appears in SCOPe 2.01
  
• d1aq8a2 appears in SCOPe 2.03
  
• d1aq8a2 appears in the current release, SCOPe 2.08