Lineage for d2jd4b2 (2jd4 B:2873-3060)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052214Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries)
  8. 2052224Domain d2jd4b2: 2jd4 B:2873-3060 [230969]
    automated match to d1okqa2
    complexed with cl, mg

Details for d2jd4b2

PDB Entry: 2jd4 (more details), 1.9 Å

PDB Description: mouse laminin alpha1 chain, domains lg4-5
PDB Compounds: (B:) laminin subunit alpha-1

SCOPe Domain Sequences for d2jd4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jd4b2 b.29.1.0 (B:2873-3060) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vaqegtffegsgyaalvkegykvrldlqitlefrttskngvllgissakvdaigleivdg
kvlfhvnngagritatyqpraaralcdgkwhtlqahkskhrivltvdgnsvraesphths
tsadtndpiyvggypahikqnslssrasfrgcvrnlrlsrgsqvqsldlsrafdlqgvfp
hscpgpep

SCOPe Domain Coordinates for d2jd4b2:

Click to download the PDB-style file with coordinates for d2jd4b2.
(The format of our PDB-style files is described here.)

Timeline for d2jd4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jd4b1
View in 3D
Domains from other chains:
(mouse over for more information)
d2jd4a1