| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries) |
| Domain d2jd4b2: 2jd4 B:2873-3060 [230969] automated match to d1okqa2 complexed with cl, mg |
PDB Entry: 2jd4 (more details), 1.9 Å
SCOPe Domain Sequences for d2jd4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jd4b2 b.29.1.0 (B:2873-3060) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vaqegtffegsgyaalvkegykvrldlqitlefrttskngvllgissakvdaigleivdg
kvlfhvnngagritatyqpraaralcdgkwhtlqahkskhrivltvdgnsvraesphths
tsadtndpiyvggypahikqnslssrasfrgcvrnlrlsrgsqvqsldlsrafdlqgvfp
hscpgpep
Timeline for d2jd4b2: