Lineage for d2jj7a2 (2jj7 A:77-183)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1279958Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1279959Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1279960Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1280226Protein automated matches [226970] (3 species)
    not a true protein
  7. 1280227Species Bacillus cereus [TaxId:1396] [230945] (3 PDB entries)
  8. 1280228Domain d2jj7a2: 2jj7 A:77-183 [230965]
    Other proteins in same PDB: d2jj7a1, d2jj7b1
    automated match to d2fx0a2
    mutant

Details for d2jj7a2

PDB Entry: 2jj7 (more details), 2.1 Å

PDB Description: crystal structure of the hlyiir mutant protein with residues 170-185 substituted by alanine
PDB Compounds: (A:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2jj7a2:

Sequence, based on SEQRES records: (download)

>d2jj7a2 a.121.1.1 (A:77-183) automated matches {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidsadlvsriisaltdk

Sequence, based on observed residues (ATOM records): (download)

>d2jj7a2 a.121.1.1 (A:77-183) automated matches {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfdsadlvsriisaltdk

SCOPe Domain Coordinates for d2jj7a2:

Click to download the PDB-style file with coordinates for d2jj7a2.
(The format of our PDB-style files is described here.)

Timeline for d2jj7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jj7a1