SCOPe 2.05: Domain d2jlxa2: 2jlx A:483-618

Lineage for d2jlxa2 (2jlx A:483-618)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Dengue virus 4 [TaxId:408688] [230938] (4 PDB entries)

8. Domain d2jlxa2: 2jlx A:483-618 [230952]
   Other proteins in same PDB: d2jlxa1, d2jlxb1
   automated match to d2bhra1
   protein/RNA complex; complexed with adp, cl, mn, vo4

Details for d2jlxa2

PDB Entry: 2jlx, 2.2 Å

PDB Description: dengue virus 4 ns3 helicase in complex with ssrna and adp-vanadate

PDB Compounds: (A:) serine protease subunit ns3

SCOPe Domain Sequences for d2jlxa2:

Sequence; same for both SEQRES and ATOM records:

>d2jlxa2 c.37.1.0 (A:483-618) automated matches {Dengue virus 4 [TaxId: 408688]}
edhahwteakmlldniytpegiiptlfgperektqaidgefrlrgeqrktfvelmrrgdl
pvwlsykvasagisykdrewcftgernnqileenmeveiwtregekkklrpkwldarvya
dpmalkdfkefasgrk

Timeline for d2jlxa2:

• d2jlxa2 first appeared in SCOPe 2.03
  
• d2jlxa2 appears in SCOPe 2.04
  
• d2jlxa2 appears in SCOPe 2.06
  
• d2jlxa2 appears in the current release, SCOPe 2.08