Lineage for d2jk3a2 (2jk3 A:77-190)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728220Protein automated matches [226970] (6 species)
    not a true protein
  7. 2728221Species Bacillus cereus [TaxId:1396] [230945] (3 PDB entries)
  8. 2728222Domain d2jk3a2: 2jk3 A:77-190 [230950]
    Other proteins in same PDB: d2jk3a1, d2jk3b1
    automated match to d2fx0a2
    complexed with so4; mutant

Details for d2jk3a2

PDB Entry: 2jk3 (more details), 2.2 Å

PDB Description: crystal structure of the hlyiir mutant protein with residues 169-186 substituted by gssgssg linker
PDB Compounds: (A:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2jk3a2:

Sequence, based on SEQRES records: (download)

>d2jk3a2 a.121.1.1 (A:77-190) automated matches {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidgssgssglvsriisaltdkpni

Sequence, based on observed residues (ATOM records): (download)

>d2jk3a2 a.121.1.1 (A:77-190) automated matches {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidgglvsriisaltdkpni

SCOPe Domain Coordinates for d2jk3a2:

Click to download the PDB-style file with coordinates for d2jk3a2.
(The format of our PDB-style files is described here.)

Timeline for d2jk3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jk3a1