SCOPe 2.07: Domain d2jk3a2: 2jk3 A:77-190

Lineage for d2jk3a2 (2jk3 A:77-190)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)

6. Protein automated matches [226970] (6 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [230945] (3 PDB entries)

8. Domain d2jk3a2: 2jk3 A:77-190 [230950]
   Other proteins in same PDB: d2jk3a1, d2jk3b1
   automated match to d2fx0a2
   complexed with so4; mutant

Details for d2jk3a2

PDB Entry: 2jk3, 2.2 Å

PDB Description: crystal structure of the hlyiir mutant protein with residues 169-186 substituted by gssgssg linker

PDB Compounds: (A:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2jk3a2:

Sequence, based on SEQRES records:

>d2jk3a2 a.121.1.1 (A:77-190) automated matches {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidgssgssglvsriisaltdkpni

Sequence, based on observed residues (ATOM records):

>d2jk3a2 a.121.1.1 (A:77-190) automated matches {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidgglvsriisaltdkpni

Timeline for d2jk3a2:

• d2jk3a2 first appeared in SCOPe 2.03
  
• d2jk3a2 appears in SCOPe 2.06