| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
| Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
| Protein automated matches [226970] (4 species) not a true protein |
| Species Bacillus cereus [TaxId:1396] [230945] (3 PDB entries) |
| Domain d2jj7b2: 2jj7 B:77-183 [230947] Other proteins in same PDB: d2jj7a1, d2jj7b1 automated match to d2fx0a2 mutant |
PDB Entry: 2jj7 (more details), 2.1 Å
SCOPe Domain Sequences for d2jj7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jj7b2 a.121.1.1 (B:77-183) automated matches {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidsadlvsriisaltdk
Timeline for d2jj7b2: