SCOPe 2.03: Domain d2jdfa2: 2jdf A:86-177

Lineage for d2jdfa2 (2jdf A:86-177)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (6 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [230909] (5 PDB entries)

8. Domain d2jdfa2: 2jdf A:86-177 [230939]
   automated match to d1amma2

Details for d2jdfa2

PDB Entry: 2jdf, 1.7 Å

PDB Description: human gamma-b crystallin

PDB Compounds: (A:) gamma crystallin b

SCOPe Domain Sequences for d2jdfa2:

Sequence; same for both SEQRES and ATOM records:

>d2jdfa2 b.11.1.0 (A:86-177) automated matches {Homo sapiens [TaxId: 9606]}
gayrmkiydrdelrgqmseltddclsvqdrfhlteihslnvlegswilyempnyrgrqyl
lrpgeyrrfldwgapnakvgslrrvmdlyle

Timeline for d2jdfa2:

• d2jdfa2 is new in SCOPe 2.03-stable
  
• d2jdfa2 appears in SCOPe 2.04
  
• d2jdfa2 appears in the current release, SCOPe 2.08