![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
![]() | Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
![]() | Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
![]() | Protein automated matches [191109] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [230909] (14 PDB entries) |
![]() | Domain d2jdfa2: 2jdf A:86-175 [230939] Other proteins in same PDB: d2jdfa3 automated match to d1amma2 |
PDB Entry: 2jdf (more details), 1.7 Å
SCOPe Domain Sequences for d2jdfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jdfa2 b.11.1.0 (A:86-175) automated matches {Human (Homo sapiens) [TaxId: 9606]} gayrmkiydrdelrgqmseltddclsvqdrfhlteihslnvlegswilyempnyrgrqyl lrpgeyrrfldwgapnakvgslrrvmdly
Timeline for d2jdfa2: