Lineage for d2jdfa2 (2jdf A:86-175)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773666Species Human (Homo sapiens) [TaxId:9606] [230909] (14 PDB entries)
  8. 2773673Domain d2jdfa2: 2jdf A:86-175 [230939]
    Other proteins in same PDB: d2jdfa3
    automated match to d1amma2

Details for d2jdfa2

PDB Entry: 2jdf (more details), 1.7 Å

PDB Description: human gamma-b crystallin
PDB Compounds: (A:) gamma crystallin b

SCOPe Domain Sequences for d2jdfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdfa2 b.11.1.0 (A:86-175) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gayrmkiydrdelrgqmseltddclsvqdrfhlteihslnvlegswilyempnyrgrqyl
lrpgeyrrfldwgapnakvgslrrvmdly

SCOPe Domain Coordinates for d2jdfa2:

Click to download the PDB-style file with coordinates for d2jdfa2.
(The format of our PDB-style files is described here.)

Timeline for d2jdfa2: