SCOPe 2.04: Domain d2jlya1: 2jly A:168-482

Lineage for d2jlya1 (2jly A:168-482)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (4 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein automated matches [226986] (3 species)
   not a true protein

7. Species Dengue virus 4 [TaxId:408688] [230921] (9 PDB entries)

8. Domain d2jlya1: 2jly A:168-482 [230934]
   Other proteins in same PDB: d2jlya2, d2jlyb2
   automated match to d2bhra2
   protein/RNA complex; complexed with adp, gol, mn, po4

Details for d2jlya1

PDB Entry: 2jly, 2.4 Å

PDB Description: dengue virus 4 ns3 helicase in complex with ssrna and adp-phosphate

PDB Compounds: (A:) serine protease subunit ns3

SCOPe Domain Sequences for d2jlya1:

Sequence; same for both SEQRES and ATOM records:

>d2jlya1 c.37.1.14 (A:168-482) automated matches {Dengue virus 4 [TaxId: 408688]}
gsamgepdyevdedifrkkrltimdlhpgagktkrilpsivreallrrlrtlilaptrvv
aaemeealrglpiryqtpavksdhtgreivdlmchatfttrllsstrvpnynlivmdeah
ftdpcsvaargyistrvemgeaaaifmtatppgstdpfpqsnspiediereiperswntg
fdwitdyqgktvwfvpsikagndianclrksgkrviqlsrktfdteypktkltdwdfvvt
tdisemganfragrvidprrclkpviltdgpervilagpipvtpasaaqrrgrigrnpaq
eddqyvfsgdplknd

Timeline for d2jlya1:

• d2jlya1 first appeared in SCOPe 2.03
  
• d2jlya1 appears in SCOPe 2.05
  
• d2jlya1 appears in the current release, SCOPe 2.08