SCOPe 2.08: Domain d2jlvb1: 2jlv B:172-482

Lineage for d2jlvb1 (2jlv B:172-482)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (7 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein automated matches [226986] (8 species)
   not a true protein

7. Species Dengue virus 4 [TaxId:408688] [230921] (9 PDB entries)

8. Domain d2jlvb1: 2jlv B:172-482 [230930]
   Other proteins in same PDB: d2jlva2, d2jlva3, d2jlvb2, d2jlvb3
   automated match to d2bhra2
   protein/RNA complex; complexed with anp, cl, gol, mn

Details for d2jlvb1

PDB Entry: 2jlv, 2.3 Å

PDB Description: dengue virus 4 ns3 helicase in complex with ssrna and amppnp

PDB Compounds: (B:) serine protease subunit ns3

SCOPe Domain Sequences for d2jlvb1:

Sequence; same for both SEQRES and ATOM records:

>d2jlvb1 c.37.1.14 (B:172-482) automated matches {Dengue virus 4 [TaxId: 408688]}
gepdyevdedifrkkrltimdlhpgagktkrilpsivrealkrrlrtlilaptrvvaaem
eealrglpiryqtpavksdhtgreivdlmchatfttrllsstrvpnynlivmdeahftdp
csvaargyistrvemgeaaaifmtatppgsidpfpqsnspiediereiperswntgfdwi
tdyqgktvwfvpsikagndianclrksgkrviqlsrktfdteypktkltdwdfvvttdis
emganfragrvidprrclkpviltdgpervilagpipvtpasaaqrrgrigrnpaqeddq
yvfsgdplknd

Timeline for d2jlvb1:

• d2jlvb1 first appeared in SCOPe 2.03
  
• d2jlvb1 appears in SCOPe 2.07