Lineage for d2jlvb1 (2jlv B:172-482)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870435Family c.37.1.14: RNA helicase [52724] (7 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2870520Protein automated matches [226986] (8 species)
    not a true protein
  7. 2870523Species Dengue virus 4 [TaxId:408688] [230921] (9 PDB entries)
  8. 2870534Domain d2jlvb1: 2jlv B:172-482 [230930]
    Other proteins in same PDB: d2jlva2, d2jlva3, d2jlvb2, d2jlvb3
    automated match to d2bhra2
    protein/RNA complex; complexed with anp, cl, gol, mn

Details for d2jlvb1

PDB Entry: 2jlv (more details), 2.3 Å

PDB Description: dengue virus 4 ns3 helicase in complex with ssrna and amppnp
PDB Compounds: (B:) serine protease subunit ns3

SCOPe Domain Sequences for d2jlvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jlvb1 c.37.1.14 (B:172-482) automated matches {Dengue virus 4 [TaxId: 408688]}
gepdyevdedifrkkrltimdlhpgagktkrilpsivrealkrrlrtlilaptrvvaaem
eealrglpiryqtpavksdhtgreivdlmchatfttrllsstrvpnynlivmdeahftdp
csvaargyistrvemgeaaaifmtatppgsidpfpqsnspiediereiperswntgfdwi
tdyqgktvwfvpsikagndianclrksgkrviqlsrktfdteypktkltdwdfvvttdis
emganfragrvidprrclkpviltdgpervilagpipvtpasaaqrrgrigrnpaqeddq
yvfsgdplknd

SCOPe Domain Coordinates for d2jlvb1:

Click to download the PDB-style file with coordinates for d2jlvb1.
(The format of our PDB-style files is described here.)

Timeline for d2jlvb1: