![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
![]() | Protein automated matches [190211] (5 species) not a true protein |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [186967] (5 PDB entries) |
![]() | Domain d2jleb_: 2jle B: [230920] Other proteins in same PDB: d2jlea2 automated match to d2jlea1 complexed with i15 |
PDB Entry: 2jle (more details), 2.9 Å
SCOPe Domain Sequences for d2jleb_:
Sequence, based on SEQRES records: (download)
>d2jleb_ e.8.1.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa ikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplde dfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyq ymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvq pivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaele laenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgaht ndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntppl vklwyqle
>d2jleb_ e.8.1.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa ikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplde dfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyq ymddlyvgsdleigqhrtkieelrqhllrwglttpmgyelhpdkwtvqpivlpekdswtv ndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepv hgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqk ittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyqle
Timeline for d2jleb_: