SCOP 1.55: Domain d1as6b1: 1as6 B:4-166

Lineage for d1as6b1 (1as6 B:4-166)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (3 families)

5. Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)

6. Protein Nitrite reductase, NIR [49551] (3 species)

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (9 PDB entries)

8. Domain d1as6b1: 1as6 B:4-166 [23092]

Details for d1as6b1

PDB Entry: 1as6, 2 Å

PDB Description: structure of nitrite bound to oxidized alcaligenes faecalis nitrite reductase at cryo temperature

SCOP Domain Sequences for d1as6b1:

Sequence; same for both SEQRES and ATOM records:

>d1as6b1 b.6.1.3 (B:4-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk

Timeline for d1as6b1:

• d1as6b1 appears in SCOP 1.57
  
• d1as6b1 appears in the current release, SCOPe 2.08