Lineage for d2jk3b1 (2jk3 B:4-76)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1258262Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1258528Protein automated matches [230914] (1 species)
    not a true protein
  7. 1258529Species Bacillus cereus [TaxId:1396] [230915] (2 PDB entries)
  8. 1258533Domain d2jk3b1: 2jk3 B:4-76 [230919]
    Other proteins in same PDB: d2jk3a2, d2jk3b2
    automated match to d2fx0a1
    complexed with so4; mutant

Details for d2jk3b1

PDB Entry: 2jk3 (more details), 2.2 Å

PDB Description: crystal structure of the hlyiir mutant protein with residues 169-186 substituted by gssgssg linker
PDB Compounds: (B:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2jk3b1:

Sequence, based on SEQRES records: (download)

>d2jk3b1 a.4.1.9 (B:4-76) automated matches {Bacillus cereus [TaxId: 1396]}
sreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkyg
lanelpnfleknq

Sequence, based on observed residues (ATOM records): (download)

>d2jk3b1 a.4.1.9 (B:4-76) automated matches {Bacillus cereus [TaxId: 1396]}
sreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkyg
llpnfleknq

SCOPe Domain Coordinates for d2jk3b1:

Click to download the PDB-style file with coordinates for d2jk3b1.
(The format of our PDB-style files is described here.)

Timeline for d2jk3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jk3b2