SCOPe 2.08: Domain d2jk3a1: 2jk3 A:4-76

Lineage for d2jk3a1 (2jk3 A:4-76)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein automated matches [230914] (1 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [230915] (2 PDB entries)

8. Domain d2jk3a1: 2jk3 A:4-76 [230918]
   Other proteins in same PDB: d2jk3a2, d2jk3b2
   automated match to d2fx0a1
   complexed with so4; mutant

Details for d2jk3a1

PDB Entry: 2jk3, 2.2 Å

PDB Description: crystal structure of the hlyiir mutant protein with residues 169-186 substituted by gssgssg linker

PDB Compounds: (A:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2jk3a1:

Sequence; same for both SEQRES and ATOM records:

>d2jk3a1 a.4.1.9 (A:4-76) automated matches {Bacillus cereus [TaxId: 1396]}
sreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkyg
lanelpnfleknq

Timeline for d2jk3a1:

• d2jk3a1 first appeared in SCOPe 2.03
  
• d2jk3a1 appears in SCOPe 2.07