Lineage for d2jdqa_ (2jdq A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006934Species Human (Homo sapiens) [TaxId:9606] [189070] (40 PDB entries)
  8. 2006943Domain d2jdqa_: 2jdq A: [230912]
    Other proteins in same PDB: d2jdqd_, d2jdqe_
    automated match to d3tj3a_
    protein/RNA complex

Details for d2jdqa_

PDB Entry: 2jdq (more details), 2.2 Å

PDB Description: c-terminal domain of influenza a virus polymerase pb2 subunit in complex with human importin alpha5
PDB Compounds: (A:) importin alpha-1 subunit

SCOPe Domain Sequences for d2jdqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdqa_ a.118.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsdmiemifskspeqqlsatqkfrkllskepnppidevistpgvvarfveflkrkenctl
qfesawvltniasgnslqtriviqagavpifiellssefedvqeqavwalgniagdstmc
rdyvldcnilppllqlfskqnrltmtrnavwalsnlcrgkspppefakvspclnvlswll
fvsdtdvladacwalsylsdgpndkiqavidagvcrrlvellmhndykvvspalravgni
vtgddiqtqvilncsalqsllhllsspkesikkeacwtisnitagnraqiqtvidanifp
alisilqtaefrtrkeaawaitnatsggsaeqikylvelgcikplcdlltvmdskivqva
lnglenilrlgeqeakrngtginpycalieeaygldkieflqshenqeiyqkafdliehy
fgte

SCOPe Domain Coordinates for d2jdqa_:

Click to download the PDB-style file with coordinates for d2jdqa_.
(The format of our PDB-style files is described here.)

Timeline for d2jdqa_: